td01_034692m, td19278758 (mRNA) Tripalus databasica

Overview
Nametd01_034692m
Unique Nametd19278758
TypemRNA
OrganismTripalus databasica (Tripalus databasica)
Sequence length1182
Homology
BLAST of td01_034692m vs. ExPASy Swiss-Prot
Match: PGLR3_ARATH (Probable polygalacturonase At3g15720 OS=Arabidopsis thaliana GN=At3g15720 PE=1 SV=1)

HSP 1 Score: 370.933 bits (951), Expect = 8.231e-102
Identity = 193/372 (51.88%), Postives = 259/372 (69.62%), Query Frame = 1
Query:   82 ASSVSVIQFGAVGDGETDDSQAFLKAWKSICGSKSNAPPLLVPAGKTFLLNPVSFQGPCKSSSINVQIQGNIVAPHSSAWDGHDKKKWLLFSNVNGLTVNGNGKIDGKAL----YLKFATTSTKFYCCNNLVFRGLMHVDSPGNHISVYGCNDVSISNLKIIAPESSPNTDGIDITHSSNVQIRDCTIATGDDCVAIGTDTSNIAVTGVICGPGHGISIGSLGANGGTSIVEDVHVRDCTFKGTKNGARIKTWQGGSGHARRISFERIKLESSDNPIIIDQYY-CGPNDECKN-QTSAVKVSDVSYIGFQGTSSTEEAVQLSCSESVGCTDIKIND--IDITHSDSGKDTRASCINAHGELYGRLVPSVDCL 1173
            ++++ V QFGAVGDG TDDSQAFLKAW+++C    +    +VPAG TF+L P+ FQG CKS+ + VQ+ G +VAP    W G DK +W+LF+++ GL + G+G+I+G+      +     T+ KF  CNNL   GL H+DSP  HI +  CN V+IS+L+I APESSPNTDGID+  SSNV I+DC IATGDDC+AI + TSNI ++G+ CGPGHGISIGSLG +G T+ VE+V V++C F+GT NGARIKTWQGGSG+AR I+F  I L++ +NPIIIDQ+Y  G +D  K+ ++SAV+VS V +  F GTS +E  V   CSE V CT+I + D  I+   S SG+  +  C+N  G      VP ++CL
Sbjct:   21 SNALDVTQFGAVGDGVTDDSQAFLKAWEAVCSGTGDGQ-FVVPAGMTFMLQPLKFQGSCKSTPVFVQMLGKLVAPSKGNWKG-DKDQWILFTDIEGLVIEGDGEINGQGSSWWEHKGSRPTALKFRSCNNLRLSGLTHLDSPMAHIHISECNYVTISSLRINAPESSPNTDGIDVGASSNVVIQDCIIATGDDCIAINSGTSNIHISGIDCGPGHGISIGSLGKDGETATVENVCVQNCNFRGTMNGARIKTWQGGSGYARMITFNGITLDNVENPIIIDQFYNGGDSDNAKDRKSSAVEVSKVVFSNFIGTSKSEYGVDFRCSERVPCTEIFLRDMKIETASSGSGQVAQGQCLNVRG-ASTIAVPGLECL 389          
BLAST of td01_034692m vs. ExPASy Swiss-Prot
Match: PGLR5_ARATH (Probable polygalacturonase At1g80170 OS=Arabidopsis thaliana GN=At1g80170 PE=2 SV=1)

HSP 1 Score: 306.99 bits (785), Expect = 1.460e-82
Identity = 158/382 (41.36%), Postives = 229/382 (59.95%), Query Frame = 1
Query:   55 QPREAFPSYASSVSVIQFGAVGDGETDDSQAFLKAWKSICGSKSNAPPLLVPAGKTFLLNPVSFQGPCKSSSINVQIQGNIVAPHS-SAWDGHDKKKWLLFSNVNGLTVNGNGKIDGKALY-------------LKFATTSTKFYCCNNLVFRGLMHVDSPGNHISVYGCNDVSISNLKIIAPESSPNTDGIDITHSSNVQIRDCTIATGDDCVAIGTDTSNIAVTGVICGPGHGISIGSLGANGGTSIVEDVHVRDCTFKGTKNGARIKTWQGGSGHARRISFERIKLESSDNPIIIDQYYCGPNDECKNQTSAVKVSDVSYIGFQGTSSTEEAVQLSCSESVGCTDIKINDIDITHSDSGKDTRASCINAHGELYGRLVP 1158
            Q R   P     + V  FGA G+G TDD++AF  AWK+ C SK     +LVP   T LL P+   GPCK+  + +QI G I+AP+    W+G +++KWL F  ++ LTV G G ++G                  + A T+  F+ C N+    L  +DS   HI++  C  V+IS LK+IAP +SPNTDGI I+ S  + I + T++TGDDC++I  +++ I+++ +ICGPGHGISIGSLG +     V D+ V       T NG RIKTWQGGSG   +I F  IK+ +  NPIIIDQYYC     C NQTSA+ + ++S++  +GTS+++EA+++SCS+S  C +I + DID+  S+    T + C  A+G   G++ P
Sbjct:   41 QSRSTRPRSERLLHVGNFGAKGNGVTDDTKAFADAWKTACSSKVKTR-ILVPENYTCLLRPIDLSGPCKAR-LTLQISGTIIAPNDPDVWEGLNRRKWLYFHGLSRLTVEGGGTVNGMGQEWWERSCKHNHSNPCRGAPTALTFHKCKNMRVENLNVIDSQQMHIALTSCRRVTISGLKVIAPATSPNTDGIHISVSRGIVIDNTTVSTGDDCISIVKNSTQISISNIICGPGHGISIGSLGKSKSWEEVRDITVDTAIISDTANGVRIKTWQGGSGLVSKIIFRNIKMNNVSNPIIIDQYYCDSRKPCANQTSAISIENISFVHVRGTSASKEAIKISCSDSSPCRNILLQDIDLEPSNGDGFTESFCWEAYGSSSGQVYP 420          
BLAST of td01_034692m vs. ExPASy Swiss-Prot
Match: PGLR_PERAE (Polygalacturonase OS=Persea americana PE=2 SV=1)

HSP 1 Score: 293.508 bits (750), Expect = 1.670e-78
Identity = 160/361 (44.32%), Postives = 214/361 (59.28%), Query Frame = 1
Query:   85 SSVSVIQFGAVGDGETDDSQAFLKAWKSICGSKSNAPPLLVPAGKTFLLNPVSFQGPCKSSSINVQIQGNIVAPHS-SAWDGHDKKKWLLFSNVNGLTVNGNGKIDG-------------KALYLKFATTSTKFYCCNNLVFRGLMHVDSPGNHISVYGCNDVSISNLKIIAPESSPNTDGIDITHSSNVQIRDCTIATGDDCVAIGTDTSNIAVTGVICGPGHGISIGSLGANGGTSIVEDVHVRDCTFKGTKNGARIKTWQGGSGHARRISFERIKLESSDNPIIIDQYYCGPNDECKNQTSAVKVSDVSYIGFQGTSSTEEAVQLSCSESVGCTDIKINDIDITHSDSGKDTRASCIN 1125
            + +SV  FGA GDG TDD++AF KAWK  C S S    L+VP  K +LL  ++F GPCKS  + V+I+G I A    S W GH++K+W+ F +++ LT+ G G  +G             K+L  K A T+  F  C NL+   L   DS   H+S   C DV  SNL + APE SPNTDGI IT +  + + +  I TGDDC++I + +  +  T + CGPGHGISIGSLG     + V  V V       T NG RIKTWQGGSG A+ I F+ I + +  NPIIIDQYYC   D C  Q SAVKVS+V+Y+  +GTS++E AV+  CS+S  C    + +I++   + GK+T  SC N
Sbjct:   83 TDISVDDFGARGDG-TDDTKAFEKAWKDACSSGS---VLIVPENKNYLLKQITFSGPCKSD-LRVKIRGTIEASSDQSDWVGHNRKRWIEFEDISNLTLEGGGTSNGNGETWWDSSCKRKKSLPCKSAPTALTFRSCKNLIVSDLSIKDSQKMHLSFDKCQDVIASNLMVTAPEHSPNTDGIHITGTQRIHVMNSVIGTGDDCISIESGSKMVIATNITCGPGHGISIGSLGDRNSEAHVSGVLVDGGNLFDTTNGLRIKTWQGGSGSAKNIKFQNIVMHNVTNPIIIDQYYCDSKDPCPEQESAVKVSNVAYMNIRGTSASEVAVKFDCSKSSPCQGYIVGNINLV-GNGGKETTMSCSN 437          
BLAST of td01_034692m vs. ExPASy Swiss-Prot
Match: PGLR2_CRYJA (Polygalacturonase OS=Cryptomeria japonica PE=1 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 1.563e-76
Identity = 162/380 (42.63%), Postives = 228/380 (60.00%), Query Frame = 1
Query:   94 SVIQFGAVGDGETDDSQAFLKAWKSICGSKSNAPPLLVPAGKTFLLNPVSFQGPCKSSSINVQIQGNIVAPHSSAWDGHDKKKWLLFSNVNGLTVNGNGKIDGK-----ALYLKFAT-----------TSTKFYCCNNLVFRGLMHVDSPGNHISVYGCNDVSISNLKIIAPESSPNTDGIDITHSSNVQIRDCTIATGDDCVAIGTDTSNIAVTGVICGPGHGISIGSLGANGGTSIVEDVHVRDCTFKGTKNGARIKTWQGGSGHARRISFERIKLESSDNPIIIDQYYCGPNDECKNQTSAVKVSDVSYIGFQGTSSTEEAVQLSCSESVGCTDIKINDIDITHSDSGKDTRASCI--NAHGELYGRLVPSVDCLLP 1179
            +V ++GAVGDG+ D ++AF  AW++ C  K  +  LLVP  K F++N + F GPC+      ++ G I+A + +     + + WL F+ + G T+ G G IDG+     A   K+             T+ KF     L+ +GL  ++SP  H+    C  V I  + I AP  SPNTDGIDI  S N  ++  TI TGDDCVAIGT +SNI +  +ICGPGHGISIGSLG     + V  VHV    F  T+NG RIKTWQGGSG A  I +E +++ +S+NPI+I+Q+YC     C+NQ SAV++ DV+Y   +GTS+T  A+QL CS+S+ C DIK++DI +  + SGK   ASC+  NA+G   G ++P+   L P
Sbjct:   60 NVEKYGAVGDGKHDCTEAFSTAWQAAC--KKPSAMLLVPGNKKFVVNNLFFNGPCQPH-FTFKVDG-IIAAYQNPASWKNNRIWLQFAKLTGFTLMGKGVIDGQGKQWWAGQCKWVNGREICNDRDRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNTDGIDIFASKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAEVSYVHVNGAKFIDTQNGLRIKTWQGGSGMASHIIYENVEMINSENPILINQFYCTSASACQNQRSAVQIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISLKLT-SGK--IASCLNDNANGYFSGHVIPACKNLSP 432          
BLAST of td01_034692m vs. ExPASy Swiss-Prot
Match: PGLR2_CHAOB (Polygalacturonase OS=Chamaecyparis obtusa PE=1 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 2.257e-75
Identity = 161/385 (41.82%), Postives = 225/385 (58.44%), Query Frame = 1
Query:   82 ASSVSVIQFGAVGDGETDDSQAFLKAWKSICGSKSNAPPLLVPAGKTFLLNPVSFQGPCKSSSINVQIQGNIVA-PHSSAWDGHDKKKWLLFSNVNGLTVNGNGKIDGKALYL----------------KFATTSTKFYCCNNLVFRGLMHVDSPGNHISVYGCNDVSISNLKIIAPESSPNTDGIDITHSSNVQIRDCTIATGDDCVAIGTDTSNIAVTGVICGPGHGISIGSLGANGGTSIVEDVHVRDCTFKGTKNGARIKTWQGGSGHARRISFERIKLESSDNPIIIDQYYCGPNDECKNQTSAVKVSDVSYIGFQGTSSTEEAVQLSCSESVGCTDIKINDIDITHSDSGKDTRASCI--NAHGELYGRLVPSVDCLLP 1179
            A+  +V Q+GAVGDG+ D ++AF   W + C  K  +  LLVPA K F +N + F+GPC+   ++ ++ G IVA P  + W   + K WL F+ +    + G G IDG+                    +   T+ K     ++  + L  ++SP  H+    C  V I  LKI AP  SPNTDGIDI  S    I  C I TGDDC+AIGT +SNI +  +ICGPGHGISIGSLG +   + V  VHV    F  T+NG RIKTWQGGSG A  I++E +++ +S+NPI+I+Q+YC     C+NQ SAV++  V+Y    GTS+T  A+QL CS+SV CT I+++++ +  + SGK   ASC+  NA G   GRL+P+   L P
Sbjct:   56 ATVFNVEQYGAVGDGKHDSTEAFATTWNAAC--KKASAVLLVPANKKFFVNNLVFRGPCQPH-LSFKVDGTIVAQPDPARWK--NSKIWLQFAQLTDFNLMGTGVIDGQGQQWWAGQCKVVNGRTVCNDRNRPTAIKIDYSKSVTVKELTLMNSPEFHLVFGECEGVKIQGLKIKAPRDSPNTDGIDIFASKRFHIEKCVIGTGDDCIAIGTGSSNITIKDLICGPGHGISIGSLGRDNSRAEVSHVHVNRAKFIDTQNGLRIKTWQGGSGLASYITYENVEMINSENPILINQFYCTSASACQNQRSAVQIQGVTYKNIHGTSATAAAIQLMCSDSVPCTGIQLSNVSLKLT-SGKP--ASCVDKNARGFYSGRLIPTCKNLRP 432          
BLAST of td01_034692m vs. ExPASy Swiss-Prot
Match: ADPG1_ARATH (Polygalacturonase ADPG1 OS=Arabidopsis thaliana GN=ADPG1 PE=2 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 2.496e-74
Identity = 163/375 (43.47%), Postives = 220/375 (58.67%), Query Frame = 1
Query:   82 ASSVSVIQFGAVGDGETDDSQAFLKAWKSICGSKSNAPPLLVPAGKTFLLNPVSFQGPCKSSSINVQIQGNIVAPHSSAWDGHDKKKWLLFSNVNGLTV--------NGNGK--------IDGKALYLKFATTSTKFYCCNNLVFRGLMHVDSPGNHISVYGCNDVSISNLKIIAPESSPNTDGIDITHSSNVQIRDCTIATGDDCVAIGTDTSNIAVTGVICGPGHGISIGSLGANGGTSIVEDVHVRDCTFKGTKNGARIKTWQGGSGHARRISFERIKLESSDNPIIIDQYYCGPNDECKNQTSAVKVSDVSYIGFQGTSSTEEAVQLSCSESVGCTDIKINDIDITHSDSGKDTRASCINAHGELYGRLVP 1158
            AS+VSV  FGA GDG+TDD+QAF KAWK  C S +     LVP GKT+LL    F+GPCKS   N QI G + A    + D  DK  WL+  +VN L++        NGNGK        ID      K A T+   Y   NL  + L   ++    IS+  CN V +SN++I AP  SPNTDGI IT++ N+++ +  I TGDDC++I   T N+ +  + CGPGHGISIGSLG +   + V  ++V    F  + NG RIKT+QGGSG A+ I F+ I++E+  NPIIIDQ YC   D+C++Q SAV+V +V Y    GTS+T+ A+ L+CSE   C  I + ++ I      K   ASC NA+ +  G + P
Sbjct:   65 ASTVSVSNFGAKGDGKTDDTQAFKKAWKKAC-STNGVTTFLVPKGKTYLLKSTRFRGPCKSLR-NFQILGTLSASTKRS-DYKDKNHWLILEDVNNLSIDGGSTGIINGNGKTWWQNSCKIDKSKPCTK-APTALTLYNLKNLNVKNLRVKNAQQIQISIEKCNKVEVSNVEITAPGDSPNTDGIHITNTQNIRVSNSDIGTGDDCISIEDGTQNLQIFDLTCGPGHGISIGSLGDDNSKAYVSGINVDGAKFSESDNGVRIKTYQGGSGTAKNIKFQNIRMENVKNPIIIDQDYC-DKDKCEDQESAVQVKNVVYKNISGTSATDVAITLNCSEKYPCQGIVLENVKI------KGGTASCKNANVKNQGTVSP 428          
BLAST of td01_034692m vs. ExPASy Swiss-Prot
Match: PGLR_ACTDE (Polygalacturonase OS=Actinidia deliciosa PE=2 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 5.560e-74
Identity = 154/361 (42.66%), Postives = 212/361 (58.73%), Query Frame = 1
Query:   82 ASSVSVIQFGAVGDGETDDSQAFLKAWKSICGSKSNAPPLLVPAGKTFLLNPVSFQGPCKSSSINVQIQGNIVAPHSSAWDGHDKKKWLLFSNVNGL------TVNGNGKI-------DGKALYLKFATTSTKFYCCNNLVFRGLMHVDSPGNHISVYGCNDVSISNLKIIAPESSPNTDGIDITHSSNVQIRDCTIATGDDCVAIGTDTSNIAVTGVICGPGHGISIGSLGANGGTSIVEDVHVRDCTFKGTKNGARIKTWQGGSGHARRISFERIKLESSDNPIIIDQYYCGPNDECKNQTSAVKVSDVSYIGFQGTSSTEEAVQLSCSESVGCTDIKINDIDITHSDSGKDTRASCIN 1125
            + +V+V  FGA GDG  DD++AF KAWK+ C S S+A  LLVP  K +L+ P+SF GPCKS  + +QI G I A    +    D + WL+F +V  L      T+NGNGKI         KAL  K A T+  FY   +++ + L   ++   H+S   C +V  SNL + APE+SPNTDGI +T + N+ I  C I TGDDC++I   +  + V  + CGPGHGISIGSLG     + V DV V      GT NG RIKTWQGGSG A  I F+ +++ + +NPIIIDQ YC  +  C+ Q+SAV+V +V Y   +GT ++  A+   CS+   C  I + D+D+   + G   +A C N
Sbjct:   87 SKTVNVDDFGAKGDGR-DDTKAFEKAWKAACSSTSSAV-LLVPK-KNYLVRPISFSGPCKSG-LTMQIYGTIEASDDRSDYRKDGRHWLVFDSVQNLRVEGGGTINGNGKIWWQNSCKTNKALPCKDAPTALTFYKSKHVIVKNLKIENAQQIHVSFDNCVNVQASNLMVTAPENSPNTDGIHVTGTQNIHISSCVIGTGDDCISIVNGSRKVRVNDITCGPGHGISIGSLGYGNSEAHVSDVVVNGAKLCGTTNGVRIKTWQGGSGSASNIKFQNVEMHNVENPIIIDQNYCDQDKPCQEQSSAVQVKNVVYQNIKGTCASNVAITFDCSKRFPCQGIVLEDVDL-EIEGGAAAKALCNN 442          
BLAST of td01_034692m vs. ExPASy Swiss-Prot
Match: ADPG2_ARATH (Polygalacturonase ADPG2 OS=Arabidopsis thaliana GN=ADPG2 PE=2 SV=2)

HSP 1 Score: 269.626 bits (688), Expect = 2.583e-71
Identity = 151/373 (40.48%), Postives = 220/373 (58.98%), Query Frame = 1
Query:   85 SSVSVIQFGAVGDGETDDSQAFLKAWKSICGSKSNAPPLLVPAGKTFLLNPVSFQGPCKSSSINVQIQGNIVAPHSSAWDGHDKKKWLLFSNVNGLTVNGN--GKIDG-------------KALYLKFATTSTKFYCCNNLVFRGLMHVDSPGNHISVYGCNDVSISNLKIIAPESSPNTDGIDITHSSNVQIRDCTIATGDDCVAIGTDTSNIAVTGVICGPGHGISIGSLGANGGTSIVEDVHVRDCTFKGTKNGARIKTWQGGSGHARRISFERIKLESSDNPIIIDQYYCGPNDECKNQTSAVKVSDVSYIGFQGTSSTEEAVQLSCSESVGCTDIKINDIDITHSDSGKDTRASCINAHGELYGRLVP 1158
            ++VSV  FGA GDG+TDD+QAF+ AWK  C S + A  LLVP G T+LL  +   GPC +S + VQI G + A    + D  D  KW++F  VN L+V+G   G +DG             KA     A T+  FY   +L+ + L   ++    IS+  C++V +SN+ + AP  SPNTDGI IT++ N+++ +  I TGDDC++I + + N+ +  + CGPGHGISIGSLG +   + V  V V      GT NG RIKT+QGGSG A  I F+ I++++  NPIIIDQ YC    +C  + SAV+V +V Y    GTS++E A+  +CS++  C  I ++ ++I      K  +A+C NA+    G ++P
Sbjct:   66 TTVSVSDFGAKGDGKTDDTQAFVNAWKKACSS-NGAVNLLVPKGNTYLLKSIQLTGPC-NSILTVQIFGTLSASQKRS-DYKDISKWIMFDGVNNLSVDGGDTGVVDGNGETWWQNSCKRNKAKPCTKAPTALTFYNSKSLIVKNLKVRNAQQIQISIEKCSNVQVSNVVVTAPADSPNTDGIHITNTQNIRVSESIIGTGDDCISIESGSQNVQINDITCGPGHGISIGSLGDDNSKAFVSGVTVDGAKLSGTDNGVRIKTYQGGSGTASNIIFQNIQMDNVKNPIIIDQDYC-DKSKCTTEKSAVQVKNVVYRDISGTSASENAITFNCSKNYPCQGIVLDRVNI------KGGKATCTNANVVDKGAVLP 428          
BLAST of td01_034692m vs. ExPASy Swiss-Prot
Match: PGLR2_JUNAS (Polygalacturonase OS=Juniperus ashei GN=JNA2 PE=1 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 4.405e-71
Identity = 153/379 (40.37%), Postives = 214/379 (56.46%), Query Frame = 1
Query:   94 SVIQFGAVGDGETDDSQAFLKAWKSICGSKSNAPPLLVPAGKTFLLNPVSFQGPCKSSSINVQIQGNIVA-PHSSAWDGHDKKKWLLFSNVNGLTVNGNGKIDGKALYL----------------KFATTSTKFYCCNNLVFRGLMHVDSPGNHISVYGCNDVSISNLKIIAPESSPNTDGIDITHSSNVQIRDCTIATGDDCVAIGTDTSNIAVTGVICGPGHGISIGSLGANGGTSIVEDVHVRDCTFKGTKNGARIKTWQGGSGHARRISFERIKLESSDNPIIIDQYYCGPNDECKNQTSAVKVSDVSYIGFQGTSSTEEAVQLSCSESVGCTDIKINDIDITHSDSGKDTRASCINAHGELYGRLVPSVDCLLP 1179
            +V  +GAVGDG+ D + AF K W + C   S     LVPA K F++N + F GPC+    + ++ G I A P  + W   + K W+ F+ +    + G G IDG+                    K   T+ K     ++  + L   +SP  H+    C+ V I  +KI AP  SPNTDGIDI  S   +I  CTI TGDDCVA+GT +SNI +  + CGPGHG+SIGSLG     S V  VH+    F  T+NG RIKTWQGGSG A  I++E +++ +++NPI+I+Q+YC     CKNQ SAVK+ DV++    GTS+T  A+QL CS+SV C++IK++++ +  + SGK       NA+G     L PS   L P
Sbjct:   61 NVEHYGAVGDGKHDSTDAFEKTWNAACNKLSAV--FLVPANKKFVVNNLVFYGPCQPH-FSFKVDGTIAAYPDPAKWK--NSKIWMHFARLTDFNLMGTGVIDGQGNRWWSDQCKTINGRTVCNDKGRPTAIKIDFSKSVTVKELTLTNSPEFHLVFGECDGVKIQGIKIKAPRDSPNTDGIDIFASKRFEIEKCTIGTGDDCVAVGTGSSNITIKDLTCGPGHGMSIGSLGKGNSRSEVSFVHLDGAKFIDTQNGLRIKTWQGGSGLASHITYENVEMINAENPILINQFYCTSAAACKNQRSAVKIQDVTFKNIHGTSATTAAIQLMCSDSVPCSNIKLSNVFLKLT-SGKVATCVNKNANGYYTNPLNPSCKSLHP 433          
BLAST of td01_034692m vs. ExPASy Swiss-Prot
Match: PGLR_MALDO (Polygalacturonase OS=Malus domestica PE=2 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 7.514e-71
Identity = 157/374 (41.98%), Postives = 213/374 (56.95%), Query Frame = 1
Query:   82 ASSVSVIQFGAVGDGETDDSQAFLKAWKSICGSKSNAPPLLVPAGKTFLLNPVSFQGPCKSSSINVQIQGNIVAPHSSAWDGHDKKKWLLFSNVNGL------TVNGNGKIDGK-ALYLK-------FATTSTKFYCCNNLVFRGLMHVDSPGNHISVYGCNDVSISNLKIIAPESSPNTDGIDITHSSNVQIRDCTIATGDDCVAIGTDTSNIAVTGVICGPGHGISIGSLGANGGTSIVEDVHVRDCTFKGTKNGARIKTWQGGSGHARRISFERIKLESSDNPIIIDQYYCG-PNDECKNQTSAVKVSDVSYIGFQGTSSTEEAVQLSCSESVGCTDIKINDIDITHSDSGKDTRASCINAHGELYGRLVP 1158
            A ++SV  FGA G+G  DD+QAF+KAWK+ C S S A  L+VP  K +L+ P+ F GPCKS  + +QI G I A    +    D   WL+F NV  L      T+NGNG I  K +  +K       +A T+  F  CNNLV + L   D+   H+    C +V  S L + APE SPNTDGI +T++ N+ I    I TGDDC++I + +  +  T + CGPGHGISIGSLG +G    V  V V      GT NG RIKTW+GGSG A  I F+ +++    NPIIIDQ YC     +CK Q SAV+V +V Y   +GTS++ +A+ L+CS+SV C  I +  + +      ++ RA C N      G + P
Sbjct:   96 AKTISVDDFGAKGNG-ADDTQAFVKAWKAACSS-SGAMVLVVPQ-KNYLVRPIEFSGPCKSQ-LTLQIYGTIEASEDRSIY-KDIDHWLIFDNVQNLLVVGPGTINGNGNIWWKNSCKIKPQPPCGTYAPTAVTFNRCNNLVVKNLNIQDAQQIHVIFQNCINVQASCLTVTAPEDSPNTDGIHVTNTQNITISSSVIGTGDDCISIVSGSQRVQATDITCGPGHGISIGSLGEDGSEDHVSGVFVNGAKLSGTSNGLRIKTWKGGSGSATNIVFQNVQMNDVTNPIIIDQNYCDHKTKDCKQQKSAVQVKNVLYQNIRGTSASGDAITLNCSQSVPCQGIVLQSVQL------QNGRAECNNVQPAYKGVVSP 458          
The following BLAST results are available for this feature:
BLAST of td01_034692m vs. ExPASy Swiss-Prot
Analysis Date: 2011-06-28 (Blast vs ExPASy SwissProt of Tripalus databasica v1.0 transcripts)
Total hits: 157
Match NameE-valueIdentityDescription
PGLR3_ARATH8.231e-10251.88Probable polygalacturonase At3g15720 OS=Arabidopsi... [more]
PGLR5_ARATH1.460e-8241.36Probable polygalacturonase At1g80170 OS=Arabidopsi... [more]
PGLR_PERAE1.670e-7844.32Polygalacturonase OS=Persea americana PE=2 SV=1[more]
PGLR2_CRYJA1.563e-7642.63Polygalacturonase OS=Cryptomeria japonica PE=1 SV=... [more]
PGLR2_CHAOB2.257e-7541.82Polygalacturonase OS=Chamaecyparis obtusa PE=1 SV=... [more]
ADPG1_ARATH2.496e-7443.47Polygalacturonase ADPG1 OS=Arabidopsis thaliana GN... [more]
PGLR_ACTDE5.560e-7442.66Polygalacturonase OS=Actinidia deliciosa PE=2 SV=1[more]
ADPG2_ARATH2.583e-7140.48Polygalacturonase ADPG2 OS=Arabidopsis thaliana GN... [more]
PGLR2_JUNAS4.405e-7140.37Polygalacturonase OS=Juniperus ashei GN=JNA2 PE=1 ... [more]
PGLR_MALDO7.514e-7141.98Polygalacturonase OS=Malus domestica PE=2 SV=1[more]

Pages

back to top
InterPro
Analysis Name: InterProScan analysis of Tripalus databasica v1.0 transcripts
Date Performed: 2011-06-28
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000743Glycoside hydrolase, family 28PFAMPF00295Glyco_hydro_28coord: 66..377
score: 3.8
IPR000743Glycoside hydrolase, family 28PROSITEPS00502POLYGALACTURONASEcoord: 231..244
score
IPR006626Parallel beta-helix repeatSMARTSM00710no descriptioncoord: 174..200
score: 5.5e+02coord: 201..222
score: 3.3coord: 224..244
score: 2.3e+03coord: 254..275
score: 18coord: 350..378
score: 1.3
IPR011050Pectin lyase fold/virulence factorSUPERFAMILY51126Pectin lyase-likecoord: 12..390
score: 2.7e
IPR012334Pectin lyase foldGENE3D2.160.20.10no descriptioncoord: 23..390
score: 1.7e
NoneNo IPR availableSEGsegsegcoord: 2..9
score
NoneNo IPR availableSIGNALPSignalP-NN(euk)signal-peptidecoord: 1..18
score

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Chr1chromosomeChr1:188539..190480 -
Properties
Property NameValue
TdIDtd19278758
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
td01_034692m.gtd01_034692m.gTripalus databasicagene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
td01_034692mtd19278758Tripalus databasicapolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
td19278758-CDS-Chr1:190336..190480td19278758-CDS-Chr1:190336..190480Tripalus databasicaCDS
td19278758-CDS-Chr1:190078..190216td19278758-CDS-Chr1:190078..190216Tripalus databasicaCDS
td19278758-CDS-Chr1:189862..189986td19278758-CDS-Chr1:189862..189986Tripalus databasicaCDS
td19278758-CDS-Chr1:189713..189756td19278758-CDS-Chr1:189713..189756Tripalus databasicaCDS
td19278758-CDS-Chr1:189489..189680td19278758-CDS-Chr1:189489..189680Tripalus databasicaCDS
td19278758-CDS-Chr1:189305..189387td19278758-CDS-Chr1:189305..189387Tripalus databasicaCDS
td19278758-CDS-Chr1:189099..189208td19278758-CDS-Chr1:189099..189208Tripalus databasicaCDS
td19278758-CDS-Chr1:188882..188999td19278758-CDS-Chr1:188882..188999Tripalus databasicaCDS
td19278758-CDS-Chr1:188538..188772td19278758-CDS-Chr1:188538..188772Tripalus databasicaCDS


Annotated Terms
The following terms have been associated with this mRNA:
Vocabulary: Molecular Function
TermDefinition
GO:0047911galacturan 1,4-alpha-galacturonidase activity
GO:0019863IgE binding
GO:0004650polygalacturonase activity
Vocabulary: Biological Process
TermDefinition
GO:0010047fruit dehiscence
GO:0007047cellular cell wall organization
GO:0045490pectin catabolic process
GO:0009901anther dehiscence
GO:0005975carbohydrate metabolic process
Vocabulary: Cellular Component
TermDefinition
GO:0009505plant-type cell wall
GO:0046658anchored to plasma membrane
Vocabulary: INTERPRO
TermDefinition
IPR000743Glycoside hydrolase, family 28
IPR006626Parallel beta-helix repeat
IPR011050Pectin lyase fold/virulence factor
IPR012334Pectin lyase fold
Vocabulary: KEGG ORTHOLOGY
TermDefinition
K01184E3.2.1.15; polygalacturonase [EC:3.2.1.15]
Vocabulary: KEGG PATHWAY
TermDefinition
ko00010Glycolysis / Gluconeogenesis
Sequences
The following sequences are available for this feature:

mRNA sequence

>td19278758 ID=td19278758|Name=td01_034692m|organism=Tripalus databasica|type=mRNA|length=1182bp
GAACTTTTAATCATAATCTTGATTTTGTCCATGGCAATCTGGGGATCAAG
TTTCCAACCCCGTGAGGCATTTCCTTCTTATGCTTCGTCTGTCAGTGTGA
TCCAGTTTGGAGCTGTAGGAGATGGAGAAACAGATGATTCACAAGCTTTC
CTAAAAGCTTGGAAAAGTATTTGTGGATCAAAATCAAATGCTCCACCGCT
ACTTGTACCGGCTGGCAAAACGTTCCTTTTGAATCCTGTTAGCTTTCAAG
GTCCATGCAAGTCCTCTTCCATCAATGTTCAGATTCAAGGAAACATCGTG
GCTCCCCACAGTAGTGCCTGGGATGGTCATGATAAGAAGAAATGGCTCCT
TTTTTCTAATGTGAATGGCCTTACAGTTAACGGAAATGGAAAAATCGATG
GAAAAGCTCTGTATTTAAAATTTGCCACTACTAGTACTAAATTTTATTGC
TGCAATAACCTTGTATTCCGTGGATTGATGCATGTCGACAGCCCGGGCAA
CCATATCAGTGTATACGGCTGCAACGATGTATCCATCTCTAATCTCAAAA
TAATTGCGCCAGAATCAAGCCCTAACACTGATGGCATTGATATTACTCAC
TCGAGCAATGTTCAAATACGCGACTGCACCATTGCAACCGGAGATGATTG
TGTTGCCATTGGTACAGACACCTCAAACATTGCTGTCACTGGTGTGATAT
GTGGACCTGGTCATGGCATAAGTATTGGAAGTTTAGGAGCAAATGGAGGG
ACAAGTATTGTAGAAGATGTACATGTAAGAGATTGTACTTTCAAAGGAAC
TAAAAATGGAGCGAGGATTAAAACATGGCAGGGAGGGTCCGGACATGCCA
GAAGGATTTCTTTTGAGAGAATTAAATTAGAGTCATCTGACAACCCAATT
ATCATAGACCAATATTATTGCGGCCCTAACGATGAGTGCAAAAATCAGAC
ATCTGCAGTTAAGGTGAGCGACGTTTCCTACATTGGATTTCAAGGTACTT
CAAGCACAGAAGAAGCAGTTCAGTTAAGCTGCAGTGAAAGCGTTGGTTGC
ACTGATATTAAGATTAATGACATCGACATAACACATTCAGATTCAGGAAA
AGATACTCGTGCCTCCTGCATCAATGCTCATGGAGAATTATATGGTCGAT
TAGTTCCATCCGTAGATTGTCTTTTACCATAA
back to top

protein sequence of td01_034692m

>td19278758 ID=td19278758|Name=td01_034692m|organism=Tripalus databasica|type=polypeptide|length=394bp
ELLIIILILSMAIWGSSFQPREAFPSYASSVSVIQFGAVGDGETDDSQAF
LKAWKSICGSKSNAPPLLVPAGKTFLLNPVSFQGPCKSSSINVQIQGNIV
APHSSAWDGHDKKKWLLFSNVNGLTVNGNGKIDGKALYLKFATTSTKFYC
CNNLVFRGLMHVDSPGNHISVYGCNDVSISNLKIIAPESSPNTDGIDITH
SSNVQIRDCTIATGDDCVAIGTDTSNIAVTGVICGPGHGISIGSLGANGG
TSIVEDVHVRDCTFKGTKNGARIKTWQGGSGHARRISFERIKLESSDNPI
IIDQYYCGPNDECKNQTSAVKVSDVSYIGFQGTSSTEEAVQLSCSESVGC
TDIKINDIDITHSDSGKDTRASCINAHGELYGRLVPSVDCLLP*
back to top

mRNA from alignment at Chr1:188539..190480-

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>td19278758 ID=td19278758|Name=td01_034692m|organism=Tripalus databasica|type=mRNA|length=1942bp|location=Sequence derived from alignment at Chr1:188539..190480- (Tripalus databasica)
GAACTTTTAATCATAATCTTGATTTTGTCCATGGCAATCTGGGGATCAAG TTTCCAACCCCGTGAGGCATTTCCTTCTTATGCTTCGTCTGTCAGTGTGA TCCAGTTTGGAGCTGTAGGAGATGGAGAAACAGATGATTCACAAGTAAAA TTTTATTTCCTTAATTAGCACTCTTAATTTTCATTTACAATTAATGATTA ATTATCAAGTATCTAGGGTGTTAGTAACTAGCAAAAAGGCGGTTAATTTT ATTAATTAATTCAGGCTTTCCTAAAAGCTTGGAAAAGTATTTGTGGATCA AAATCAAATGCTCCACCGCTACTTGTACCGGCTGGCAAAACGTTCCTTTT GAATCCTGTTAGCTTTCAAGGTCCATGCAAGTCCTCTTCCATCAATGTTC AGGTAATTGGAACTGATAATGAGCAATTTTTTAAAATTATTTTTTGAATT ATATATTCTTTTCTCAAAATAAAATTTGTCTAATGTGTTCACAGATTCAA GGAAACATCGTGGCTCCCCACAGTAGTGCCTGGGATGGTCATGATAAGAA GAAATGGCTCCTTTTTTCTAATGTGAATGGCCTTACAGTTAACGGAAATG GAAAAATCGATGGAAAAGGTGCATCTTGGTGGTCAAATAAACAACACCAA AGACCCACTGTAAGCAGATTTTCACTTTTAATTTGTTAATAAATTTTGCG GGGTAAAATTATATCTTTTAACAGCTCTGTATTTAAAATTTGCCACTACT AGTACTAAATTTTATTGGTGATAATTTTGCTAGGCCTTGTCATTTGGTAG CTGCAATAACCTTGTATTCCGTGGATTGATGCATGTCGACAGCCCGGGCA ACCATATCAGTGTATACGGCTGCAACGATGTATCCATCTCTAATCTCAAA ATAATTGCGCCAGAATCAAGCCCTAACACTGATGGCATTGATATTACTCA CTCGAGCAATGTTCAAATACGCGACTGCACCATTGCAACCGGTAATTAAA TTCTAATCAAGTTGTTTAATCATCATCATCATCATAGAACTGCGGTACTT GTTCTACTCAACTAATCTTGACTAACTACAAACATGGCTGCAGGAGATGA TTGTGTTGCCATTGGTACAGACACCTCAAACATTGCTGTCACTGGTGTGA TATGTGGACCTGGTCATGGCATAAGGTTTGTAAATAAGAACTATCATATA TATTAAATTTTTTTAGTAACTAAGTGTTCTTTCTGTTAACAAAATTGAAT TGGTTGTTTTTGTAAATTGTAGTATTGGAAGTTTAGGAGCAAATGGAGGG ACAAGTATTGTAGAAGATGTACATGTAAGAGATTGTACTTTCAAAGGAAC TAAAAATGGAGCGAGGATTAAAACATGGCAGGTAACTAATCATAAATACA ATTGAGTTCTAATTGATTATTGGCAAGTAGATTAATTGAGTTATTTTTTT CCCAAAAAAAAAATTGTGATCTTGTTTTCAGGGAGGGTCCGGACATGCCA GAAGGATTTCTTTTGAGAGAATTAAATTAGAGTCATCTGACAACCCAATT ATCATAGACCAATATTATTGCGGCCCTAACGATGAGTGCAAAAATCAGGT GATACTAAATGAGCGAAATTCGATTAAAGCGATTTTATCAGTTGAACCAA CTACATACCCACTAAAAGTTATTGTTTTTGTCAATTTTATATGCATCCGA TGTTGCAGACATCTGCAGTTAAGGTGAGCGACGTTTCCTACATTGGATTT CAAGGTACTTCAAGCACAGAAGAAGCAGTTCAGTTAAGCTGCAGTGAAAG CGTTGGTTGCACTGATATTAAGATTAATGACATCGACATAACACATTCAG ATTCAGGAAAAGATACTCGTGCCTCCTGCATCAATGCTCATGGAGAATTA TATGGTCGATTAGTTCCATCCGTAGATTGTCTTTTACCATAA
back to top

Coding sequence (CDS) from alignment at Chr1:188539..190480-

>td19278758 ID=td19278758|Name=td01_034692m|organism=Tripalus databasica|type=CDS|length=1182bp|location=Sequence derived from alignment at Chr1:188539..190480- (Tripalus databasica)
GAACTTTTAATCATAATCTTGATTTTGTCCATGGCAATCTGGGGATCAAG
TTTCCAACCCCGTGAGGCATTTCCTTCTTATGCTTCGTCTGTCAGTGTGA
TCCAGTTTGGAGCTGTAGGAGATGGAGAAACAGATGATTCACAAGCTTTC
CTAAAAGCTTGGAAAAGTATTTGTGGATCAAAATCAAATGCTCCACCGCT
ACTTGTACCGGCTGGCAAAACGTTCCTTTTGAATCCTGTTAGCTTTCAAG
GTCCATGCAAGTCCTCTTCCATCAATGTTCAGATTCAAGGAAACATCGTG
GCTCCCCACAGTAGTGCCTGGGATGGTCATGATAAGAAGAAATGGCTCCT
TTTTTCTAATGTGAATGGCCTTACAGTTAACGGAAATGGAAAAATCGATG
GAAAAGCTCTGTATTTAAAATTTGCCACTACTAGTACTAAATTTTATTGC
TGCAATAACCTTGTATTCCGTGGATTGATGCATGTCGACAGCCCGGGCAA
CCATATCAGTGTATACGGCTGCAACGATGTATCCATCTCTAATCTCAAAA
TAATTGCGCCAGAATCAAGCCCTAACACTGATGGCATTGATATTACTCAC
TCGAGCAATGTTCAAATACGCGACTGCACCATTGCAACCGGAGATGATTG
TGTTGCCATTGGTACAGACACCTCAAACATTGCTGTCACTGGTGTGATAT
GTGGACCTGGTCATGGCATAAGTATTGGAAGTTTAGGAGCAAATGGAGGG
ACAAGTATTGTAGAAGATGTACATGTAAGAGATTGTACTTTCAAAGGAAC
TAAAAATGGAGCGAGGATTAAAACATGGCAGGGAGGGTCCGGACATGCCA
GAAGGATTTCTTTTGAGAGAATTAAATTAGAGTCATCTGACAACCCAATT
ATCATAGACCAATATTATTGCGGCCCTAACGATGAGTGCAAAAATCAGAC
ATCTGCAGTTAAGGTGAGCGACGTTTCCTACATTGGATTTCAAGGTACTT
CAAGCACAGAAGAAGCAGTTCAGTTAAGCTGCAGTGAAAGCGTTGGTTGC
ACTGATATTAAGATTAATGACATCGACATAACACATTCAGATTCAGGAAA
AGATACTCGTGCCTCCTGCATCAATGCTCATGGAGAATTATATGGTCGAT
TAGTTCCATCCGTAGATTGTCTTTTACCATAA
back to top